The short version of Neurotrophic factor fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2026-08-01. Anything still debated is marked as such rather than presented as settled.
Reported pharmacological effects center on reduced anxiety-like behavior in animal models and on measures of memory and learning. Proposed contributing mechanisms include modulation of GABAergic signaling, shifts in monoamine turnover, and changes in the activity of enzymes that degrade neuropeptides. Effects on the expression of genes linked to neuroplasticity have also been described. No single molecular target is widely accepted, and whether the behavioral findings arise from one pathway or several remains an open question.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro. It was designed as a stabilized analogue of tuftsin, a naturally occurring tetrapeptide fragment derived from the immunoglobulin heavy chain. The additional Pro-Gly-Pro segment at the carboxyl terminus is intended to slow enzymatic cleavage. The compound is usually described in the literature as a synthetic peptide with anxiolytic and cognitive-related activity, a label that reflects a research context rather than an approved therapeutic category.
Pharmacokinetic data are limited. Like most short peptides, Selank is vulnerable to plasma and tissue peptidases, and its measured half-life in circulation is short, on a minutes scale. The Pro-Gly-Pro tail slows this degradation but does not eliminate it. Intranasal administration is the route described in most reports, with absorption through the nasal mucosa and a hypothesized path into the central nervous system that avoids the blood-brain barrier. Direct measurements of human brain exposure are unavailable, so distribution claims rest on inference from animal work.
Clinical evidence comes mainly from small studies conducted in Russia, several of which were open-label or lacked robust blinding. Reported outcomes include lower anxiety scores, changes in attention measures, and effects on asthenic states following illness. Sample sizes are typically in the tens of participants, and independent replication outside the region is scarce. Reviews published in English generally note the limited methodological quality of the underlying trials. Whether the compound produces clinically meaningful effects under rigorous conditions remains unresolved.
Proposed mechanisms center on modulation of the GABA system, but no single molecular target has been confirmed. Rodent studies report changes in GABA-A receptor expression and in the turnover of serotonin, dopamine, and norepinephrine in several brain regions. Increases in brain-derived neurotrophic factor and its receptor have also been described after repeated administration. These findings come largely from animal models, and the degree to which they describe human neurochemistry remains an open question. The mechanism is best characterized as multi-system and not fully resolved.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C33H57N11O9 | Derived from the seven-residue sequence |
| Molecular weight | About 751.9 g/mol | Average mass; the monoisotopic value is slightly lower |
| Residue count | Seven amino acids | Thr-Lys-Pro-Arg-Pro-Gly-Pro |
| Parent compound | Tuftsin (Thr-Lys-Pro-Arg) | Selank extends tuftsin at the C-terminus |
| Compound class | Synthetic short peptide | Studied in a research setting; not a licensed drug in most markets |
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography, with mass spectrometry used to confirm molecular mass and sequence information. Amino acid analysis and peptide mapping may supplement these methods. Certified reference standards are scarce, and many commercial lots are sold as research chemicals without a pharmacopoeial monograph. Regulatory treatment differs by country: Selank is a registered prescription medicine in Russia, while in the European Union and the United States it is not an approved drug and may fall under research-chemical or unapproved-product frameworks.
Selank is a hydrophilic peptide and dissolves readily in water and in aqueous buffers. The lyophilised powder is typically a white to off-white solid. Because short peptides are prone to hydrolysis and oxidation, handling benefits from limiting exposure to heat, moisture and strong light. Working solutions are commonly prepared in sterile water or saline, and repeated freeze-thaw cycles are avoided to reduce aggregation and loss of activity. These practices reflect general laboratory convention rather than published stability specifications.
Measuring peptide exposure inside the brain is technically difficult. Selank is degraded rapidly in plasma, and assays must separate intact peptide from fragments, which favors targeted mass spectrometry over immunoassays alone. Reported half-lives are short, on the order of minutes, so effects observed hours later are attributed to downstream signaling rather than to the parent compound. Blood-brain barrier permeability is debated and rarely quantified directly. Gaps include absent dose-response characterization, inconsistent reporting of purity, and almost no pharmacokinetic data from human participants.
Selank is studied chiefly as an animal-model anxiolytic with proposed secondary effects on memory and immune signaling. Reported mechanisms include modulation of the GABA-A receptor complex, inhibition of enkephalin-degrading enzymes, and shifts in monoamine turnover within limbic structures. Some experiments describe increased expression of brain-derived neurotrophic factor in the hippocampus after repeated dosing. No single molecular target has been confirmed, and the peptide does not bind any receptor with the selectivity typical of a conventional small-molecule drug. Mechanism therefore remains a set of hypotheses rather than an established pathway.
Solubility behavior is a practical concern for handling. Selank dissolves readily in water and in common aqueous buffers, which simplifies preparation of working solutions. The choice of solvent, ionic strength, and pH can influence aggregation over time, particularly at higher concentrations. Aqueous solutions are typically sterile-filtered before use. Because stability depends on several variables, storage and handling notes should be treated as general guidance rather than fixed rules, and specific values are best confirmed against a certificate of analysis for each batch.
Characterization of Selank in a laboratory setting relies on standard peptide methods. Reverse-phase high-performance liquid chromatography separates the target from related impurities and provides a purity figure, commonly reported as 95 percent or higher. Mass spectrometry, typically electrospray ionization or matrix-assisted laser desorption, confirms the molecular mass and helps detect truncation or modification. Amino acid analysis can verify composition when a sequence-level check is needed. These techniques together establish identity and purity for a given lot.
Lyophilized Selank, the dry powder form, is generally stored frozen at minus 20 degrees Celsius or colder for long-term keeping. The solid is hygroscopic and should stay sealed, dry, and protected from light. Once dissolved, the peptide is less stable and is usually held refrigerated at 2 to 8 degrees Celsius for short periods. Repeated freezing and thawing is avoided because it can promote aggregation and loss of activity. Buffers and pH choice also affect how long a solution remains usable.
The reaction proceeds in two stages. The first protein component, called RebP, is an oxidase which contains heme and uses oxygen and nicotinamide adenine dinucleotide (NADH) to form the new aromatic bond between the indole components, making a six-membered ring. The RebP component then acts with a flavin-dependent partner called RebC to remove the two carboxylic acid groups by oxidative decarboxylation.
Humps which mostly contain fat can shrink or disappear depending on conditions. When camels are born, the humps are small and may appear deflated, but will grow as the calf begins to eat solid food. Adult camels that suffer extreme stress, such as heavy parasite loads, may lose their humps due to depletion of fat reserves. Captive plains bison may arch their backs (or "hump up") as a stress response, especially if in close confinement, which can create the illusion that their actual hump is much lower at the shoulders. Humps can take different forms, even between closely related species. The dromedary camel has only one hump, while the bactrian camel has two. This may be due to differences in fat metabolism rates, as the two-humped bactrian evolved lipid metabolism more rapidly. Yaks have humps comparable to the breastbone of a bird, while zebus have lump-like humps; when the two are crossbred, the yak's hump gene is dominant over the zebu's. In some cattle breeds, like the Drakensberger and Nguni, the hump is sexually dimorphic, with only bulls having one. In other breeds, like the Boran, both sexes have a hump, but it is larger in the male.
== Silver nanoparticles in toothpaste == Silver nanoparticles are used for catalyzing chemical reactions, Raman imaging, and antimicrobial sterilization. Along with its antimicrobial properties, its low mammalian cell toxicity makes these particles a common addition to consumer products. Washing textiles embedded with silver nanoparticles results in the oxidation and transformation of metallic Ag into AgCl. Silver nanoparticles have different physicochemical characteristics from the free silver ion, Ag+ and possess increased optical, electromagnetic, and catalytic properties. Particles with one dimension of 100 nm or less can generate reactive oxygen species. Smaller particles less than 10 nm may pass through cellular membranes and accumulate within the cell. Silver nanoparticles were also found to attach to cellular membranes, eventually dissipating the proton motive force, leading to cell death. Silver nanoparticles that are larger than the openings of membrane channel proteins can easily clog channels, leading to the disruption of membrane permeability and transport. However, the antimicrobial effectiveness of silver nanoparticles has been shown to decrease when dissolved in liquid media. The free silver ion are potentially toxic to bacteria and planktonic species in the water. The positively charged silver ion can also attach to the negatively charged cell walls of bacteria, leading to deactivation of cellular enzymes, disruption of membrane permeability, and eventually, cell lysis and death.
=== Setting === Echoes is set in the same location and time frame as that of Half-Life, taking place at a remote New Mexico laboratory called the Black Mesa Research Facility, showing the events of Half-Life from the perspective of a different protagonist. The player assumes the role of an unnamed character, referred to as "Candidate Twelve," a scientist.
Sources: en.wikipedia.org
January 23: Law granting an additional benefit to pregnant women already receiving allowances under the law of August 5, 1914. June 18: Law amending the law of April 7, 1915, authorizing the government to revoke naturalization decrees of former nationals of enemy countries: naturalized persons from a country at war with France can be stripped of French nationality, and this loss may extend to the wife and children depending on circumstances. July 27: Law establishing "Wards of the Nation"; women may hold positions in national and departmental offices. August 5: Law concerning breastfeeding in industrial and commercial establishments. October 1: Law on the repression of public drunkenness and regulation of drinking establishments; part of a campaign against clandestine prostitution by both women and men. Additionally, girls under 18 may no longer work in drinking establishments unless they are family members of the owner. 1919
== Medical uses == Arsenic trioxide has emerged as a therapeutic agent in cancer treatment, especially for acute promyelocytic leukemia (APL). It achieves high remission rates, including among patients with relapsed disease, and offering advantages over other treatments like bone marrow transplantation and all-trans retinoic acid (ATRA), particularly by reducing toxicity and improving patient outcomes. The combined regimen of arsenic trioxide with ATRA is now considered a standard of care for newly diagnosed and relapsed APL, showing substantial efficacy even in pediatric and elderly populations. Arsenic trioxide is intended for the induction of remission and consolidation in adult patients with acute promyelocytic leukemia who have the t(15;17) translocation and/or the fusion of PML and RARα genes. The drug should be used after treatment failure or relapse. Prior therapy should include retinoid and chemotherapy. The current standard of care for acute promyelocytic leukemia (APL) is risk-adapted therapy based on the patient’s white blood cell count at diagnosis. For patients with non-high-risk APL (typically defined as a white blood cell count ≤10,000/μL), the preferred treatment is a chemotherapy-free regimen that combines all-trans retinoic acid (ATRA) and arsenic trioxide (ATO), which has demonstrated superior efficacy and a favorable safety profile compared to regimens that include chemotherapy.
NADPH deficiency can cause a dysfunction in glutathione peroxidase which is an enzyme that converts hydrogen peroxide (a reactive oxygen species) into water. G6PD (glucose-6-phosphate dehydrogenase) deficiency exacerbated by administration of oxidant drugs (e.g., primaquine, dapsone, quinidine) can also result in Heinz bodies. G6PD deficient red cells in combination with high levels of oxidants causes a cross-linking of sulfhydryl groups on globin chains which causes a denaturing and formation of Heinz body precipitates. Heinz bodies can also be found in chronic liver disease. Alpha-thalassemia. Normal adult hemoglobin is composed of two alpha and two beta chains. Alpha thalassemia patients have partial or complete defects in alpha globin production, leading to a relative abundance of beta globin chains in the cell. These excess beta globin chains aggregate to form HbH, which has decreased solubility and precipitates in the red blood cell cytoplasm. This is not direct damage to hemoglobin per se, but rather a perturbation in the quaternary structure of hemoglobin. The presence of Heinz bodies may also be a feature of hyposplenism or asplenia, when a damaged or absent spleen cannot remove these damaged cells from circulation.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Since the fraction of nuclides decaying per unit of time is inversely proportional to an isotope's half-life, the relative radioactivity of the lesser amount of human-produced radioisotopes (thousands of tons instead of trillions of tons) would diminish once the isotopes with far shorter half-lives than the bulk of natural radioisotopes decayed. In January 2013, Cumbria county council rejected UK central government proposals to start work on an underground storage dump for nuclear waste near to the Lake District National Park. "For any host community, there will be a substantial community benefits package and worth hundreds of millions of pounds" said Ed Davey, Energy Secretary, but nonetheless, the local elected body voted 7–3 against research continuing, after hearing evidence from independent geologists that "the fractured strata of the county was impossible to entrust with such dangerous material and a hazard lasting millennia." Horizontal drillhole disposal describes proposals to drill over one km vertically, and two km horizontally in the earth's crust, for the purpose of disposing of high-level waste forms such as spent nuclear fuel, Caesium-137, or Strontium-90. After the emplacement and the retrievability period, drillholes would be backfilled and sealed. A series of tests of the technology were carried out in November 2018 and then again publicly in January 2019 by a U.S. based private company. The test demonstrated the emplacement of a test-canister in a horizontal drillhole and retrieval of the same canister.
Sources: en.wikipedia.org
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro, designed as a metabolically stabilized analogue of the endogenous tetrapeptide tuftsin. It has been studied mainly against anxiety-related and cognitive endpoints rather than as an approved medicine in most jurisdictions.
Tuftsin contains four residues, while selank carries an additional Pro-Gly-Pro segment at the carboxyl end. That extension is intended to reduce enzymatic cleavage. Comparative pharmacokinetic data in humans remain limited.
No single receptor target is widely accepted as the definitive mediator of the reported effects. Proposed contributors include GABAergic modulation, shifts in monoamine turnover, and altered neuropeptide degradation. The mechanism is treated in the literature as unresolved.
Reports describe effects on GABA-A receptor expression, monoamine turnover, and neurotrophic factor levels. These are proposed mechanisms drawn mainly from animal models. No single molecular target has been established.